A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10085
Swiss-prot Accession number	Q9PWG3 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control
Protein Length	217 Amino acids
Molecular weight	24942
References	1   Komano T., Takebe S., Taguchi Y., Sakai H.; "Cloning and sequencing of cDNA that encodes ostrich growth hormone."; Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	TFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEEQRHANKNSQSAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVYEKLKDLEEGIQALMRELEDRSSRGPPLLRSTYDKFDIHLRNEEALLKNYGLPSCFKKDLHKVETYLKVMKCRRFGESNCTI
Position of mature hormone in Pre-Hormone protein	191 Residues from position (27-217)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10112
Swiss-prot Accession number	P80663 (Sequence in FASTA format)
Description	Follitropin subunit beta (Follicle-stimulating hormone beta subunit)(FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	106 Amino acids
Molecular weight	11947
References	1  PubMed abstract 8925835 2  PubMed abstract 8925835
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITIAVEREECELCITVNATWCSGYCFTRDPVYKYPPVSEVQQTCTFKEVVYETVKIPGCRDHAESLYSYPVATECHCETCDTDSTDCTVRGLGPSYCSFNQ
Position of mature hormone in Pre-Hormone protein	106 Residues from position (1-106)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10117
Swiss-prot Accession number	P80665 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain (Anterior pituitary glycoproteinhormones common subunit alpha) (Follitropin alpha chain) (Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alpha chain)(Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropin alphachain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	96 Amino acids
Molecular weight	10782
References	1  PubMed abstract 8925835
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFLMQGCPECKLGENRFFSKPGAPVYQCTGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKAFTKITLKDNVKIENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (1-96)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10127
Swiss-prot Accession number	P80664 (Sequence in FASTA format)
Description	Lutropin subunit beta (Luteinizing hormone subunit beta) (LSH-beta)(LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	128 Amino acids
Molecular weight	12856
References	1  PubMed abstract 8925835
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	VPLGVPVALGVPPSRPPCRPVNVTVAAEKDECPQCLAVTTTACGGYCRTREPVYRSPLGGPAQQACGYGALRYERLALPGCAPGADPTVAVPVALSCRCARCPMATADCTVAGLGPAFCGAPAGFGPQ
Position of mature hormone in Pre-Hormone protein	128 Residues from position (1-128)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 5

HMRbase accession number	10280
Swiss-prot Accession number	Q9PU29 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14273
References	1  PubMed abstract 11072120
Domain Name	Gastrin
Hormone Name	Cholecystokinin-70
Mature Hormone Sequence	APSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	70 Residues from position (49-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 6

HMRbase accession number	10281
Swiss-prot Accession number	Q9PU29 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14273
References	1  PubMed abstract 11072120
Domain Name	Gastrin
Hormone Name	Cholecystokinin-8
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (111-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 7

HMRbase accession number	10282
Swiss-prot Accession number	Q9PU29 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14273
References	1  PubMed abstract 11072120
Domain Name	Gastrin
Hormone Name	Cholecystokinin-7
Mature Hormone Sequence	YMGWMDF
Position of mature hormone in Pre-Hormone protein	7 Residues from position (112-118)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 8

HMRbase accession number	10695
Swiss-prot Accession number	P11967 (Sequence in FASTA format)
Description	Pancreatic hormone (Pancreatic polypeptide) (PP).
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	36 Amino acids
Molecular weight	4209
References	1  PubMed abstract 3623804
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	GPAQPTYPGDDAPVEDLVRFYDNLQQYLNVVTRHRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (1-36)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 9

HMRbase accession number	10899
Swiss-prot Accession number	P67969 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 3045031
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	AANQHLCGSHLVEALYLVCGERGFFYSPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (1-30)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10900
Swiss-prot Accession number	P67969 (Sequence in FASTA format)
Description	Insulin [Contains: Insulin B chain; Insulin A chain].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	51 Amino acids
Molecular weight	5698
References	1  PubMed abstract 3045031
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHNTCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (31-51)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10975
Swiss-prot Accession number	P01196 (Sequence in FASTA format)
Description	Corticotropin (Adrenocorticotropic hormone) (ACTH) [Contains:Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	39 Amino acids
Molecular weight	4626
References	1  PubMed abstract 208539 2  PubMed abstract 208539
Domain Name	ACTH_domain
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGRKRRPVKVYPNGVQEETSEGFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (1-39)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10976
Swiss-prot Accession number	P01196 (Sequence in FASTA format)
Description	Corticotropin (Adrenocorticotropic hormone) (ACTH) [Contains:Melanotropin alpha (Alpha-MSH); Corticotropin-like intermediarypeptide (CLIP)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	39 Amino acids
Molecular weight	4626
References	1  PubMed abstract 208539 2  PubMed abstract 208539
Domain Name	ACTH_domain
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (1-13)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	11128
Swiss-prot Accession number	P68953 (Sequence in FASTA format)
Description	Glucagon.
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis
Protein Length	29 Amino acids
Molecular weight	3470
References	1  PubMed abstract 1938110
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDTRRAQDFVQWLMST
Position of mature hormone in Pre-Hormone protein	29 Residues from position (1-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	11194
Swiss-prot Accession number	Q9PU29 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)].
Source organism	Struthio camelus (Ostrich)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine
Post translational modification	The precursor is cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear
Protein Length	130 Amino acids
Molecular weight	14273
References	1  PubMed abstract 11072120
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS
Position of mature hormone in Pre-Hormone protein	110 Residues from position (21-130)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated